PDB entry 1k85

View 1k85 on RCSB PDB site
Description: Solution structure of the fibronectin type III domain from Bacillus circulans WL-12 Chitinase A1.
Class: hydrolase
Keywords: fibronectin type III domain, chitinase, chitin binding domain, carbohydrase, horizontal gene transfer, HYDROLASE
Deposited on 2001-10-23, released 2002-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chitinase a1
  Species: Bacillus circulans [TaxId:1397]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20533 (2-87)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1k85a1, d1k85a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k85A (A:)
  hmaptaptnlastaqttssitlswtastdnvgvtgydvyngtalattvtgttatisglaa
  dtsytftvkakdaagnvsaasnavsvkt