PDB entry 1k82

View 1k82 on RCSB PDB site
Description: Crystal structure of E.coli formamidopyrimidine-DNA glycosylase (Fpg) covalently trapped with DNA
Class: hydrolase/DNA
Keywords: protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex
Deposited on 2001-10-22, released 2002-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: fpg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k82a1, d1k82a2, d1k82a3
  • Chain 'B':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: fpg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k82b1, d1k82b2, d1k82b3
  • Chain 'C':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: fpg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k82c1, d1k82c2, d1k82c3
  • Chain 'D':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: fpg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k82d1, d1k82d2, d1k82d3
  • Chain 'E':
    Compound: 5'-d(*gp*gp*cp*tp*tp*cp*cp*tp*cp*cp*tp*gp*g)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*gp*cp*tp*tp*cp*cp*tp*cp*cp*tp*gp*g)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*gp*cp*tp*tp*cp*cp*tp*cp*cp*tp*gp*g)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*gp*cp*tp*tp*cp*cp*tp*cp*cp*tp*gp*g)-3'
  • Chain 'I':
    Compound: 5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3'
  • Chain 'J':
    Compound: 5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3'
  • Chain 'K':
    Compound: 5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3'
  • Chain 'L':
    Compound: 5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k82A (A:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkdflqsdgkpgyfaqelqvygrkg
    epcrvcgtpivatkhaqratfycrqcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k82A (A:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkpgyfaqelqvygrkgepcrvcgt
    pivatkhaqratfycrqcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k82B (B:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkdflqsdgkpgyfaqelqvygrkg
    epcrvcgtpivatkhaqratfycrqcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k82B (B:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkpgyfaqelqvygrkgepcrvcgt
    pivatkhaqratfycrqcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k82C (C:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkdflqsdgkpgyfaqelqvygrkg
    epcrvcgtpivatkhaqratfycrqcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k82C (C:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkpgyfaqelqvygrkgepcrvcgt
    pivatkhaqratfycrqcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k82D (D:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkdflqsdgkpgyfaqelqvygrkg
    epcrvcgtpivatkhaqratfycrqcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k82D (D:)
    pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
    elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
    ghnvlthlgpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagi
    hpdrlasslslaecellarvikavllrsieqggttlkpgyfaqelqvygrkgepcrvcgt
    pivatkhaqratfycrqcqk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.