PDB entry 1k7s

View 1k7s on RCSB PDB site
Description: FhuD complexed with albomycin-delta 2
Class: transport protein
Keywords: two mixed domains connected by an alpha helix, TRANSPORT PROTEIN
Deposited on 2001-10-21, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: ferrichrome-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07822 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d1k7sn1, d1k7sn2
  • Heterogens: ALB, HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1k7sN (N:)
    gidpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlel
    ltemkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaa
    ethlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawq
    getnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpa
    vwfygatlsamhfvrvldnaiggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k7sN (N:)
    gidpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlel
    ltemkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaa
    ethlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawq
    getnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpa
    vwfygatlsamhfvrvldnaig