PDB entry 1k7k

View 1k7k on RCSB PDB site
Description: crystal structure of RdgB- inosine triphosphate pyrophosphatase from E. coli
Class: structural genomics, unknown function
Keywords: MAD, His-tag, large groove, disordered Se-Met, structural genomics, Putative ribosomal protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2001-10-19, released 2002-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yggV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52061 (22-218)
      • expression tag (10-18)
      • expression tag (21)
      • modified residue (22)
      • modified residue (127)
    Domains in SCOPe 2.06: d1k7ka1, d1k7ka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k7kA (A:)
    mgsshhhhhhssgrenlyfqghmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvds
    aeetgltfienailkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqkn
    lqklletmkdvpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydp
    iffvpsegktaaeltreeksaishrgqalkllldalrnggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k7kA (A:)
    ssgrenlyfhmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfiena
    ilkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkdvp
    ddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaa
    eltreeksaishrgqalkllldalrng