PDB entry 1k7j

View 1k7j on RCSB PDB site
Description: Structural Genomics, protein TF1
Class: structural genomics, unknown function
Keywords: structural genomics, X-ray crystallography, yciO, putative translation factor, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2001-10-19, released 2002-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.195
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yciO
    Species: Escherichia coli [TaxId:562]
    Gene: yciO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45847 (0-205)
      • modified residue (0)
      • modified residue (49)
      • modified residue (67)
      • modified residue (88)
      • modified residue (120)
      • modified residue (139)
      • modified residue (145)
    Domains in SCOPe 2.08: d1k7ja_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k7jA (A:)
    msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlp
    dghnftlmcrdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktig
    mrvpsnpiaqallealgepmlstslmlpgseftesdpeeikdrlekqvdliihggylgqk
    pttvidltddtpvvvregvgdvkpfl