PDB entry 1k7h

View 1k7h on RCSB PDB site
Description: crystal structure of shrimp alkaline phosphatase
Class: hydrolase
Keywords: hydrolase, transferase, phosphomonoester, extended beta sheet, zinc triad, metal triad
Deposited on 2001-10-19, released 2002-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Pandalus borealis [TaxId:6703]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BHT8 (3-475)
      • cloning artifact (0-2)
      • conflict (258)
      • conflict (429)
    Domains in SCOPe 2.07: d1k7ha1, d1k7ha2
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Pandalus borealis [TaxId:6703]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BHT8 (3-475)
      • cloning artifact (0-2)
      • conflict (258)
      • conflict (429)
    Domains in SCOPe 2.07: d1k7hb1, d1k7hb2
  • Heterogens: NAG, ZN, SO4, MAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k7hA (A:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdiantdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsathdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k7hB (B:)
    eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
    ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
    eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
    ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
    gatasyvwnrddllavdiantdylmglfsythldtvltrdaemdptlpemtkvaiemltk
    dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
    ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
    yasaapkhsathdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd