PDB entry 1k7g

View 1k7g on RCSB PDB site
Description: PrtC from Erwinia chrysanthemi
Class: hydrolase
Keywords: protease, hydrolase, metalloprotease
Deposited on 2001-10-19, released 2002-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted protease C
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: prtc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k7ga1, d1k7ga2
  • Heterogens: CA, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k7gA (A:)
    mgknlslrqddaqhalsantssaynsvydflryhdrgdgltvngktsysidqaaaqitre
    nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
    tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
    ygrqtftheighalglahpgeynagegdpsyndavyaedsyqfsimsywgenetgadyng
    hyggapmiddiaaiqrlyganmttrtgdsvygfnsntdrdfytatdsskalifsvwdagg
    tdtfdfsgysnnqrinlnegsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadni
    lqggagndvlyggagadtlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafr
    negqlsfvqdqftgkgqevmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k7gA (A:)
    nsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanltfkflqsv
    ssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnytrdasgnl
    dygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalglahpgeyna
    gegdpsyndavyaedsyqfsimsywgenetgadynghyggapmiddiaaiqrlyganmtt
    rtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinlnegsfsd
    vgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadtlyggag
    rdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqevmlqwd
    aansitnlwlheaghssvdflvrivgqaaqsdiiv