PDB entry 1k7b

View 1k7b on RCSB PDB site
Description: NMR Solution Structure of sTva47, the Viral-Binding Domain of Tva
Class: membrane protein
Keywords: beta hairpin, 3-10 helix, calcium binding, membrane protein
Deposited on 2001-10-18, released 2001-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subgroup a rous sarcoma virus receptor pg800 and pg950
    Species: Coturnix coturnix [TaxId:9091]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98162 (6-46)
      • cloning artifact (5)
    Domains in SCOPe 2.08: d1k7ba1, d1k7ba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k7bA (A:)
    isefgscppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k7bA (A:)
    scppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcg