PDB entry 1k77

View 1k77 on RCSB PDB site
Description: Crystal Structure of EC1530, a Putative Oxygenase from Escherichia coli
Class: structural genomics, unknown function
Keywords: TIM Barrel, Hypothetical Protein, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2001-10-18, released 2002-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.194
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ygbM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46891 (0-257)
      • modified residue (0)
      • modified residue (9-10)
      • modified residue (104)
      • cloning artifact (258-259)
    Domains in SCOPe 2.07: d1k77a1, d1k77a2
  • Heterogens: MG, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k77A (A:)
mprfaanlsmmftevpfierfaaarkagfdaveflfpynystlqiqkqleqnhltlalfn
tapgdinagewglsalpgreheahadidlaleyalalnceqvhvmagvvpagedaeryra
vfidniryaadrfaphgkrilvealspgvkphylfssqyqalaiveevardnvfiqldtf
haqkvdgnlthlirdyagkyahvqiaglpdrhepddgeinypwlfrlfdevgyqgwigce
ykprglteeglgwfdawrgs