PDB entry 1k76

View 1k76 on RCSB PDB site
Description: Solution Structure of the C-terminal Sem-5 SH3 Domain (Minimized Average Structure)
Class: signaling protein
Keywords: all beta protein
Deposited on 2001-10-18, released 2003-05-20
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-20, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex muscle abnormal protein 5
    Species: Caenorhabditis elegans
    Gene: Sem-5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29355 (2-61)
      • engineered (56)
    Domains in SCOP 1.75: d1k76a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k76A (A:)
    hmetkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvapyn
    sn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k76A (A:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvapynsn