PDB entry 1k72

View 1k72 on RCSB PDB site
Description: The X-ray Crystal Structure Of Cel9G Complexed With cellotriose
Class: hydrolase
Keywords: endoglucanase, family 9, cellotriose, cellulose binding domain, (alpha-alpha)6-barrel, HYDROLASE
Deposited on 2001-10-18, released 2003-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase 9g
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: CELCCG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37700 (Start-613)
      • modified residue (256)
      • conflict (573-574)
    Domains in SCOPe 2.06: d1k72a1, d1k72a2
  • Chain 'B':
    Compound: endoglucanase 9g
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: CELCCG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37700 (Start-613)
      • modified residue (256)
      • conflict (573-574)
    Domains in SCOPe 2.06: d1k72b1, d1k72b2
  • Heterogens: GLC, CBI, CA, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k72A (A:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k72A (A:)
    tynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvkf
    nlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdgg
    kdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcisha
    knlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnwg
    keqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsytp
    kglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfvv
    gygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnneia
    cdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvynq
    tgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvyy
    vnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnipv
    ydngvkvfgnep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k72B (B:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k72B (B:)
    gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
    fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
    gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
    aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
    gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
    pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
    vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
    acdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvyn
    qtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvy
    yvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnip
    vydngvkvfgnep