PDB entry 1k72

View 1k72 on RCSB PDB site
Description: the x-ray crystal structure of cel9g complexed with cellotriose
Deposited on 2001-10-18, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k72A (A:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k72A (A:)
    tynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvkf
    nlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdgg
    kdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcisha
    knlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnwg
    keqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsytp
    kglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfvv
    gygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnneia
    cdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvynq
    tgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvyy
    vnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnipv
    ydngvkvfgnep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k72B (B:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k72B (B:)
    gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
    fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
    gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
    aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
    gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
    pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
    vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
    acdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvyn
    qtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvy
    yvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnip
    vydngvkvfgnep