PDB entry 1k70

View 1k70 on RCSB PDB site
Description: The Structure of Escherichia coli Cytosine Deaminase bound to 4-Hydroxy-3,4-Dihydro-1H-Pyrimidin-2-one
Class: hydrolase
Keywords: cytosine deaminase, alpha-beta barrel, hexamer, conformational change
Deposited on 2001-10-17, released 2002-02-06
The last revision prior to the SCOP 1.73 freeze date was dated 2002-02-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1k70a1, d1k70a2
  • Heterogens: FE, HPY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k70A (A:)
    snnalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvep
    hihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvr
    thvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvv
    gaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmga
    rvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvke
    mlesginvcfghddvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsart
    lnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpe
    aidykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k70A (A:)
    alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvephih
    ldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvrthv
    dvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvvgai
    phfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmgarvt
    ashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvkemle
    sginvcfghddvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsartlnl
    qdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaid
    ykr