PDB entry 1k6x

View 1k6x on RCSB PDB site
Description: Crystal structure of Nmra, a negative transcriptional regulator in complex with NAD at 1.5 A resolution (Trigonal form)
Class: transcription
Keywords: Rossmann fold transcriptional regulation short chain dehydrogenase reductase NADH binding, TRANSCRIPTION
Deposited on 2001-10-17, released 2002-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NmrA
    Species: Emericella nidulans [TaxId:162425]
    Gene: nmrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1k6xa_
  • Heterogens: CL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k6xA (A:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k6xA (A:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsggvisqrvtdearklwsgw
    rdmeeyarevfpieeeangldwml