PDB entry 1k6v

View 1k6v on RCSB PDB site
Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease
Deposited on 2001-10-17, released 2002-02-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k6va_
  • Chain 'B':
    Domains in SCOP 1.63: d1k6vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6vA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6vB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf