PDB entry 1k6q

View 1k6q on RCSB PDB site
Description: Crystal structure of antibody Fab fragment D3
Deposited on 2001-10-17, released 2002-04-17
The last revision prior to the SCOP 1.69 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1k6qH (H:)
    evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy
    dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkkip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k6qH (H:)
    evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy
    dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvssakt
    tppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkkip
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1k6qL (L:)
    dikmtqspssmsaslgesvtitckasrdiksylswyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespftfgsgtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k6qL (L:)
    dikmtqspssmsaslgesvtitckasrdiksylswyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespftfgsgtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceatpivksfn