PDB entry 1k6q

View 1k6q on RCSB PDB site
Description: Crystal structure of antibody Fab fragment D3
Class: immune system
Keywords: antigen-antibody recognition, crystal structure, blood coagulation, tissue factor, IMMUNE SYSTEM
Deposited on 2001-10-17, released 2002-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin Fab D3, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1K6Q (0-215)
    Domains in SCOPe 2.07: d1k6qh1, d1k6qh2
  • Chain 'L':
    Compound: immunoglobulin Fab D3, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k6ql1, d1k6ql2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1k6qH (H:)
    evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy
    dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkkip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k6qH (H:)
    evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy
    dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvssakt
    tppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkkip
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1k6qL (L:)
    dikmtqspssmsaslgesvtitckasrdiksylswyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespftfgsgtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k6qL (L:)
    dikmtqspssmsaslgesvtitckasrdiksylswyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespftfgsgtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceatpivksfn