PDB entry 1k6m

View 1k6m on RCSB PDB site
Description: crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase
Deposited on 2001-10-16, released 2002-12-11
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6mA (A:)
    nsptmvimvglpargktyistkltrylnfigtptkvfnlgqyrreavsyknyefflpdnm
    ealqirkqcalaalkdvhnylsheeghvavfdatnttrerrslilqfakehgykvffies
    icndpgiiaenirqvklgspdyidcdrekvledflkriecyevnyqpldeeldshlsyik
    ifdvgtrymvnrvqdhiqsrtvyylmnihvtprsiylcrhgeselnirgriggdsglsvr
    gkqyayalanfiqsqgisslkvftsrmkrtiqtaealgvpyeqfkalneidagvceemty
    eeiqehypeefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldksseelpylkcplhtvlkltpvaygckvesiylnveavnthrekpenvditre
    peealdtvpahy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6mB (B:)
    nsptmvimvglpargktyistkltrylnfigtptkvfnlgqyrreavsyknyefflpdnm
    ealqirkqcalaalkdvhnylsheeghvavfdatnttrerrslilqfakehgykvffies
    icndpgiiaenirqvklgspdyidcdrekvledflkriecyevnyqpldeeldshlsyik
    ifdvgtrymvnrvqdhiqsrtvyylmnihvtprsiylcrhgeselnirgriggdsglsvr
    gkqyayalanfiqsqgisslkvftsrmkrtiqtaealgvpyeqfkalneidagvceemty
    eeiqehypeefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldksseelpylkcplhtvlkltpvaygckvesiylnveavnthrekpenvditre
    peealdtvpahy