PDB entry 1k6m

View 1k6m on RCSB PDB site
Description: Crystal Structure of Human Liver 6-Phosphofructo-2-Kinase/Fructose-2,6-Bisphosphatase
Class: Transferase, Hydrolase
Keywords: tissue differentiation, isoform, domain stability, Transferase, Hydrolase
Deposited on 2001-10-16, released 2002-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2-phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16118 (0-431)
      • engineered (28)
      • engineered (262)
      • engineered (283)
      • engineered (370)
    Domains in SCOPe 2.08: d1k6ma1, d1k6ma2
  • Chain 'B':
    Compound: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2-phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16118 (0-431)
      • engineered (28)
      • engineered (262)
      • engineered (283)
      • engineered (370)
    Domains in SCOPe 2.08: d1k6mb1, d1k6mb2
  • Heterogens: PO4, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6mA (A:)
    nsptmvimvglpargktyistkltrylnfigtptkvfnlgqyrreavsyknyefflpdnm
    ealqirkqcalaalkdvhnylsheeghvavfdatnttrerrslilqfakehgykvffies
    icndpgiiaenirqvklgspdyidcdrekvledflkriecyevnyqpldeeldshlsyik
    ifdvgtrymvnrvqdhiqsrtvyylmnihvtprsiylcrhgeselnirgriggdsglsvr
    gkqyayalanfiqsqgisslkvftsrmkrtiqtaealgvpyeqfkalneidagvceemty
    eeiqehypeefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldksseelpylkcplhtvlkltpvaygckvesiylnveavnthrekpenvditre
    peealdtvpahy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6mB (B:)
    nsptmvimvglpargktyistkltrylnfigtptkvfnlgqyrreavsyknyefflpdnm
    ealqirkqcalaalkdvhnylsheeghvavfdatnttrerrslilqfakehgykvffies
    icndpgiiaenirqvklgspdyidcdrekvledflkriecyevnyqpldeeldshlsyik
    ifdvgtrymvnrvqdhiqsrtvyylmnihvtprsiylcrhgeselnirgriggdsglsvr
    gkqyayalanfiqsqgisslkvftsrmkrtiqtaealgvpyeqfkalneidagvceemty
    eeiqehypeefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldksseelpylkcplhtvlkltpvaygckvesiylnveavnthrekpenvditre
    peealdtvpahy