PDB entry 1k6c

View 1k6c on RCSB PDB site
Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease
Class: hydrolase
Keywords: indinavir, inhibitor recognition, drug resistance, hiv-1 protease, hydrolase
Deposited on 2001-10-15, released 2002-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (0-98)
      • engineered (6)
      • engineered (13)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.06: d1k6ca_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (0-98)
      • engineered (6)
      • engineered (13)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.06: d1k6cb_
  • Heterogens: ACT, MK1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6cA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k6cB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf