PDB entry 1k66

View 1k66 on RCSB PDB site
Description: Crystal Structure of the Cyanobacterial Phytochrome Response Regulator, RcpB
Deposited on 2001-10-15, released 2003-12-16
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.216
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1k66a_
  • Chain 'B':
    Domains in SCOP 1.69: d1k66b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k66A (A:)
    avgnatqpllvvedsdedfstfqrllqregvvnpiyrcitgdqaldflyqtgsycnpdia
    prpavilldlnlpgtdgrevlqeikqdevlkkipvvimttssnpkdieicysysissyiv
    kpleidrltetvqtfikywldivvlpemg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k66B (B:)
    avgnatqpllvvedsdedfstfqrllqregvvnpiyrcitgdqaldflyqtgsycnpdia
    prpavilldlnlpgtdgrevlqeikqdevlkkipvvimttssnpkdieicysysissyiv
    kpleidrltetvqtfikywldivvlpemg