PDB entry 1k66

View 1k66 on RCSB PDB site
Description: Crystal Structure of the Cyanobacterial Phytochrome Response Regulator, RcpB
Class: signaling protein
Keywords: Response Regulator, CheY homologue, homodimer, apo-protein, (beta/alpha)5, SIGNALING PROTEIN
Deposited on 2001-10-15, released 2003-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.216
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phytochrome Response Regulator RcpB
    Species: Tolypothrix sp. PCC 7601 [TaxId:1188]
    Gene: AF309560
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RTM8 (1-148)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1k66a1, d1k66a2
  • Chain 'B':
    Compound: Phytochrome Response Regulator RcpB
    Species: Tolypothrix sp. PCC 7601 [TaxId:1188]
    Gene: AF309560
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RTM8 (1-148)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1k66b1, d1k66b2
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k66A (A:)
avgnatqpllvvedsdedfstfqrllqregvvnpiyrcitgdqaldflyqtgsycnpdia
prpavilldlnlpgtdgrevlqeikqdevlkkipvvimttssnpkdieicysysissyiv
kpleidrltetvqtfikywldivvlpemg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k66B (B:)
avgnatqpllvvedsdedfstfqrllqregvvnpiyrcitgdqaldflyqtgsycnpdia
prpavilldlnlpgtdgrevlqeikqdevlkkipvvimttssnpkdieicysysissyiv
kpleidrltetvqtfikywldivvlpemg