PDB entry 1k62

View 1k62 on RCSB PDB site
Description: crystal structure of the human argininosuccinate lyase q286r mutant
Deposited on 2001-10-14, released 2002-02-01
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-01, with a file datestamp of 2002-02-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k62a_
  • Chain 'B':
    Domains in SCOP 1.59: d1k62b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k62A (A:)
    gavdpimekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvaeew
    aqgtfklnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsg
    llwelirtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdserllevrkri
    nvlplgsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthls
    rmaedlilyctkefsfvqlsdaystgsslmprkknpdslelirskagrvfgrcagllmtl
    kglpstynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdla
    yylvrkgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsv
    eqygalggtarssvdwqirqvrallqaqqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k62B (B:)
    gklwggrfvgavdpimekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilh
    gldkvaeewaqgtfklnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwm
    rqtcstlsgllwelirtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdse
    rllevrkrinvlplgsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfw
    rslcmthlsrmaedlilyctkefsfvqlsdaystgsslmprkknpdslelirskagrvfg
    rcagllmtlkglpstynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqals
    pdmlatdlayylvrkgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvi
    cvwdyrhsveqygalggtarssvdwqirqvrallqaqqa