PDB entry 1k61

View 1k61 on RCSB PDB site
Description: matalpha2 homeodomain bound to DNA
Class: transcription/DNA
Keywords: protein-DNA complex, homeodomain, hoogsteen base pair, transcription/DNA complex
Deposited on 2001-10-14, released 2002-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mating-type protein alpha-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k61a_
  • Chain 'B':
    Compound: Mating-type protein alpha-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k61b_
  • Chain 'C':
    Compound: Mating-type protein alpha-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k61c_
  • Chain 'D':
    Compound: Mating-type protein alpha-2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k61d_
  • Chain 'E':
    Compound: 5'-d(*ap*cp*ap*tp*gp*tp*ap*ap*tp*tp*cp*ap*tp*tp*tp*ap*cp*ap*cp*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*(5iu)p*gp*cp*gp*tp*gp*tp*ap*ap*ap*tp*gp*ap*ap*tp*tp*ap*cp*ap*tp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k61A (A:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k61B (B:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k61B (B:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k61C (C:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k61C (C:)
    hrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k61D (D:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k61D (D:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.