PDB entry 1k61
View 1k61 on RCSB PDB site
Description: matalpha2 homeodomain bound to DNA
Class: transcription/DNA
Keywords: protein-DNA complex, homeodomain, hoogsteen base pair, transcription/DNA complex
Deposited on
2001-10-14, released
2002-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Mating-type protein alpha-2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1k61a_ - Chain 'B':
Compound: Mating-type protein alpha-2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1k61b_ - Chain 'C':
Compound: Mating-type protein alpha-2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1k61c_ - Chain 'D':
Compound: Mating-type protein alpha-2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1k61d_ - Chain 'E':
Compound: 5'-d(*ap*cp*ap*tp*gp*tp*ap*ap*tp*tp*cp*ap*tp*tp*tp*ap*cp*ap*cp*gp*c)-3'
Species: synthetic, synthetic
- Chain 'F':
Compound: 5'-d(*(5iu)p*gp*cp*gp*tp*gp*tp*ap*ap*ap*tp*gp*ap*ap*tp*tp*ap*cp*ap*tp*g)-3'
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1k61A (A:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1k61B (B:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
Sequence, based on observed residues (ATOM records): (download)
>1k61B (B:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekti
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1k61C (C:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
Sequence, based on observed residues (ATOM records): (download)
>1k61C (C:)
hrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
- Chain 'D':
Sequence, based on SEQRES records: (download)
>1k61D (D:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
Sequence, based on observed residues (ATOM records): (download)
>1k61D (D:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.