PDB entry 1k5w

View 1k5w on RCSB PDB site
Description: three-dimensional structure of the synaptotagmin 1 c2b-domain: synaptotagmin 1 as a phospholipid binding machine
Class: endocytosis/exocytosis
Keywords: c2b-domain, c2-domain, synaptotagmin I, calcium-binding, phospholipid-binding, synapsis, neurotransmitter release, synaptic vesicle exocytosis, endocytosis/exocytosis complex
Deposited on 2001-10-12, released 2002-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k5wa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k5wA (A:)
    qeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
    ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
    wsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5wA (A:)
    klgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkkttik
    kntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhws
    dmlanprrpiaqwhtlqveeevdamlav