PDB entry 1k5u

View 1k5u on RCSB PDB site
Description: Human acidic fibroblast growth factor. 141 amino acid form with amino terminal His tag with His93 replaced by Gly (H93G).
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-10-12, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (98)
    Domains in SCOPe 2.07: d1k5ua_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (98)
    Domains in SCOPe 2.07: d1k5ub_
  • Chain 'C':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (98)
    Domains in SCOPe 2.07: d1k5uc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k5uA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5uA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k5uB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5uB (B:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k5uC (C:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5uC (C:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs