PDB entry 1k5j

View 1k5j on RCSB PDB site
Description: the crystal structure of nucleoplasmin-core
Deposited on 2001-10-10, released 2001-11-01
The last revision prior to the SCOP 1.65 freeze date was dated 2001-11-21, with a file datestamp of 2001-11-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1k5ja_
  • Chain 'B':
    Domains in SCOP 1.65: d1k5jb_
  • Chain 'C':
    Domains in SCOP 1.65: d1k5jc_
  • Chain 'D':
    Domains in SCOP 1.65: d1k5jd_
  • Chain 'E':
    Domains in SCOP 1.65: d1k5je_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k5jA (A:)
    mastvsntsklekpvsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdef
    hiveivtqeegaeksvpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhvam
    eedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5jA (A:)
    vsliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeeksvpiatlkpsi
    lpmatmvgieltppvtfrlkagsgplyisgqhva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k5jB (B:)
    mastvsntsklekpvsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdef
    hiveivtqeegaeksvpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhvam
    eedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5jB (B:)
    sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeegaeksvpiatlkp
    silpmatmvgieltppvtfrlkagsgplyisgqhva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k5jC (C:)
    mastvsntsklekpvsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdef
    hiveivtqeegaeksvpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhvam
    eedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5jC (C:)
    sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtksvpiatlkpsilpma
    tmvgieltppvtfrlkagsgplyisgqhv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k5jD (D:)
    mastvsntsklekpvsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdef
    hiveivtqeegaeksvpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhvam
    eedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5jD (D:)
    sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivteksvpiatlkpsilpm
    atmvgieltppvtfrlkagsgplyisgqhv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1k5jE (E:)
    mastvsntsklekpvsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdef
    hiveivtqeegaeksvpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhvam
    eedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5jE (E:)
    vsliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeksvpiatlkpsil
    pmatmvgieltppvtfrlkagsgplyisgqhva