PDB entry 1k5h

View 1k5h on RCSB PDB site
Description: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
Class: oxidoreductase
Keywords: alpha-helix, beta-barrel, dinucleotide binding motif, variable loop, induced fit, OXIDOREDUCTASE
Deposited on 2001-10-10, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k5ha1, d1k5ha2, d1k5ha3
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k5hb1, d1k5hb2, d1k5hb3
  • Chain 'C':
    Compound: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k5hc1, d1k5hc2, d1k5hc3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5hA (A:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k5hB (B:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5hB (B:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnrkisvdsatmmnkgleyiearwlfnasas
    qmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfcklsa
    ltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnlsvl
    ekmdrepqcvddvlsvdanarevarkevmrl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5hC (C:)
    mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas