PDB entry 1k5c

View 1k5c on RCSB PDB site
Description: Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution
Class: hydrolase
Keywords: beta helical structure, glycoside hydrolase, silver-leaf inducing substance, hydrolase
Deposited on 2001-10-10, released 2002-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.114
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endopolygalacturonase
    Species: Chondrostereum purpureum [TaxId:58369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k5ca_
  • Heterogens: NAG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k5cA (A:)
    atctvksvddakdiagcsavtlngftvpagntlvlnpdkgatvtmagditfakttldgpl
    ftidgtginfvgadhifdgngalywdgkgtnngthkphpflkikgsgtykkfevlnspaq
    aisvgptdahltldgitvddfagdtknlghntdgfdvsannvtiqncivknqddciaind
    gnnirfennqcsgghgisigsiatgkhvsnvvikgntvtrsmygvrikaqrtatsasvsg
    vtydantisgiakygvlisqsypddvgnpgtgapfsdvnftggattikvnnaatrvtvec
    gncsgnwnwsqltvtggkagtiksdkakitggqyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5cA (A:)
    ctvksvddakdiagcsavtlngftvpagntlvlnpdkgatvtmagditfakttldgplft
    idgtginfvgadhifdgngalywdgkgtnngthkphpflkikgsgtykkfevlnspaqai
    svgptdahltldgitvddfagdtknlghntdgfdvsannvtiqncivknqddciaindgn
    nirfennqcsgghgisigsiatgkhvsnvvikgntvtrsmygvrikaqrtatsasvsgvt
    ydantisgiakygvlisqsypddvgnpgtgapfsdvnftggattikvnnaatrvtvecgn
    csgnwnwsqltvtggkagtiksdkakitggqyl