PDB entry 1k5a

View 1k5a on RCSB PDB site
Description: Crystal structure of human angiogenin double variant I119A/F120A
Class: hydrolase
Keywords: Hydrolase, Ribonuclease, vascularization
Deposited on 2001-10-10, released 2002-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered (118-119)
    Domains in SCOPe 2.07: d1k5aa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k5aA (A:)
    qdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsaa
    rrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k5aA (A:)
    nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
    nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsaa