PDB entry 1k59

View 1k59 on RCSB PDB site
Description: Crystal Structure of Human Angiogenin Variant Q117G
Class: hydrolase
Keywords: hydrolase, rinonuclease, vascularization
Deposited on 2001-10-10, released 2002-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (0-122)
      • modified residue (0)
      • engineered (116)
    Domains in SCOPe 2.06: d1k59a_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k59A (A:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsif
    rrp