PDB entry 1k52

View 1k52 on RCSB PDB site
Description: Monomeric Protein L B1 Domain with a K54G mutation
Class: protein binding
Keywords: Protein L B1 domain, strained beta-hairpin turn, positive phi angles, domain swapping, amyloid formation, PROTEIN BINDING
Deposited on 2001-10-09, released 2001-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene: Protein L, B1 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (0-8)
      • engineered (54)
      • engineered (61)
    Domains in SCOPe 2.02: d1k52a_
  • Chain 'B':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene: Protein L, B1 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (0-8)
      • engineered (54)
      • engineered (61)
    Domains in SCOPe 2.02: d1k52b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k52A (A:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dggytlnikfag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k52B (B:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dggytlnikfag