PDB entry 1k50

View 1k50 on RCSB PDB site
Description: A V49A Mutation Induces 3D Domain Swapping in the B1 Domain of Protein L from Peptostreptococcus magnus
Class: protein binding
Keywords: Protein L B1 domain, strained beta-hairpin turn, positive phi angles, domain swapping, amyloid formation, PROTEIN BINDING
Deposited on 2001-10-09, released 2001-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene: Protein L, B1 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (0-62)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.02: d1k50a_
  • Chain 'B':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene: Protein L, B1 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (0-62)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.02: d1k50b_
  • Chain 'C':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene: Protein L, B1 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (0-62)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.02: d1k50c_
  • Chain 'D':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene: Protein L, B1 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (0-62)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.02: d1k50d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50A (A:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50B (B:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50C (C:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50D (D:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag