PDB entry 1k50

View 1k50 on RCSB PDB site
Description:
Deposited on 2001-10-09, released 2001-12-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1k50a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1k50b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1k50c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1k50d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50A (A:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50B (B:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50C (C:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k50D (D:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtadvadkgytlnik
    fag