PDB entry 1k4y

View 1k4y on RCSB PDB site
Description: Crystal Structure of Rabbit Liver Carboxylesterase in Complex with 4-piperidino-piperidine
Class: hydrolase
Keywords: hydrolase, esterase, side door, camptothecin, irinotecan
Deposited on 2001-10-09, released 2002-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: liver carboxylesterase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • GB AAC39258 (0-533)
    Domains in SCOPe 2.08: d1k4ya_
  • Heterogens: 4PN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4yA (A:)
    ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvkntts
    yppmcsqdavsghmlselftnrkeniplkfsedclylniytpadltkrgrlpvmvwihgg
    glmvggastydglalsahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvq
    dnianfggdpgsvtifgesaggqsvsilllspltknlfhraisesgvallsslfrkntks
    laekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpkentaflttvi
    dgvllpkapaeilaekkynmlpymvginqqefgwiipmqmlgyplsegkldqktatellw
    ksypivnvskeltpvatekylggtddpvkkkdlfldmladllfgvpsvnvarhhrdagap
    tymyeyryrpsfssdmrpktvigdhgdeifsvlgapflkegateeeiklskmvmkywanf
    arngnpngeglpqwpaydykegylqigattqaaqklkdkevafwtelwakeaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4yA (A:)
    ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvkntts
    yppmcsqdavsghmlselftnrkeniplkfsedclylniytpadltkrgrlpvmvwihgg
    glmvggastydglalsahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvq
    dnianfggdpgsvtifgesaggqsvsilllspltknlfhraisesgvallsslfrkntks
    laekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpkentaflttvi
    dgvllpkapaeilaekkynmlpymvginqqefkldqktatellwksypivnvskeltpva
    tekylggtddpvkkkdlfldmladllfgvpsvnvarhhrdagaptymyeyrhgdeifsvl
    gapflkegateeeiklskmvmkywanfarngnpngeglpqwpaydykegylqigattqaa
    qklkdkevafwtelwakeaar