PDB entry 1k4u

View 1k4u on RCSB PDB site
Description: Solution structure of the C-terminal SH3 domain of p67phox complexed with the C-terminal tail region of p47phox
Class: hormone/growth factor
Keywords: p67phox, p47phox, sh3-peptide complex, helix-turn-helix
Deposited on 2001-10-08, released 2002-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: phagocyte nadph oxidase subunit p47phox
    Species: HOMO SAPIENS
    Gene: NCF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: phagocyte nadph oxidase subunit p67phox
    Species: HOMO SAPIENS
    Gene: NCF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19878 (0-61)
      • engineered (44)
      • engineered (59)
    Domains in SCOP 1.75: d1k4us_

PDB Chain Sequences:

  • Chain 'P':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k4uS (S:)
    qlkkgsqvealfsyeatqpedlefqegdiilvlskvneewlegeskgkvgifpkvfveds
    at