PDB entry 1k4t

View 1k4t on RCSB PDB site
Description: human DNA topoisomerase I (70 kda) in complex with the poison topotecan and covalent complex with a 22 base pair DNA duplex
Class: isomerase/DNA
Keywords: Complex (Isomerase/DNA), DNA, Topoisomerase I, drug, poison
Deposited on 2001-10-08, released 2002-12-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-591)
      • modified residue (549)
    Domains in SCOPe 2.02: d1k4ta1, d1k4ta2, d1k4ta3
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(*(tgp)p*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3'
  • Heterogens: TTC, HG, TTG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4tA (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4tA (A:)
    qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
    akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
    keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
    diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekd
    wqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetad
    tvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqp
    eddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsyn
    ranravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdakt
    kkvveskkkavqrleeqlmklevqatdreenkqialgtsklnyldpritvawckkwgvpi
    ekiynktqrekfawaidmadedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.