PDB entry 1k4s

View 1k4s on RCSB PDB site
Description: human DNA topoisomerase I in covalent complex with a 22 base pair DNA duplex
Class: isomerase/DNA
Keywords: Complex (ISOMERASE/DNA), DNA, Topoisomerase I
Deposited on 2001-10-08, released 2002-12-04
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.217
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-591)
      • modified residue (549)
    Domains in SCOP 1.75: d1k4sa1, d1k4sa2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*(5iu)p*(5iu))-3'
  • Chain 'C':
    Compound: 5'-d(*(spt)p*gp*ap*ap*ap*ap*ap*(5iu)p*(5iu)p*(5iu)p*(5iu)p*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*(ido)up*(ido)up*(ido)up*(ido)up*cp*ap*ap*ap*gp*(ido)up*cp*(ido)up*(ido)up*(ido)up*(ido)up*t)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4sA (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4sA (A:)
    qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
    akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
    keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
    diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekd
    wqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetad
    tvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqp
    eddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsyn
    ranravailcnhreenkqialgtsklnyldpritvawckkwgvpiekiynktqrekfawa
    idmadedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.