PDB entry 1k4s

View 1k4s on RCSB PDB site
Description: human dna topoisomerase i in covalent complex with a 22 base pair dna duplex
Deposited on 2001-10-08, released 2002-12-04
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.217
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4sA (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4sA (A:)
    qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
    akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
    keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
    diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekd
    wqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetad
    tvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqp
    eddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsyn
    ranravailcnhreenkqialgtsklnyldpritvawckkwgvpiekiynktqrekfawa
    idmadedyef