PDB entry 1k4o

View 1k4o on RCSB PDB site
Description: Crystal Structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase in complex with one Manganese, and a glycerol
Deposited on 2001-10-08, released 2002-03-06
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1k4oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k4oA (A:)
fdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrhssglicapltp
erttaldlpqmvthnadprgtaytvsvdaehpstttgisahdralacrmlaapdaqpshf
rrpghvfplravaggvrarrghteagvelcrlagkrpvaviseivddgqevegravraap
gmlrgdecvafarrwglkvctiedmiahvektegkl