PDB entry 1k4n

View 1k4n on RCSB PDB site
Description: Structural Genomics, Protein EC4020
Class: structural genomics, unknown function
Keywords: Structural Genomics, A new fold of protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2001-10-08, released 2002-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein EC4020
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52007 (4-End)
      • cloning artifact (0-3)
      • modified residue (4)
      • modified residue (74)
    Domains in SCOPe 2.06: d1k4na1, d1k4na2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4nA (A:)
    ghmimanwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerw
    rrgfeqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehiei
    vlpgdpetlnaralallsdeglslpgisvktsspkgeherlpnptlavtdgkttikfhpw
    sieeivaseqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4nA (A:)
    ghmimanwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerw
    rrgfeqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehiei
    vlpgdpetlnaralallsdeglslpgisvktsrlpnptlavtdgkttikfhpwsieeiva
    seq