PDB entry 1k4k

View 1k4k on RCSB PDB site
Description: Crystal structure of E. coli Nicotinic acid mononucleotide adenylyltransferase
Class: transferase
Keywords: Nucleotidyltransferase
Deposited on 2001-10-08, released 2002-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinic acid mononucleotide adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1k4ka_
  • Chain 'B':
    Compound: Nicotinic acid mononucleotide adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1k4kb_
  • Chain 'C':
    Compound: Nicotinic acid mononucleotide adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1k4kc_
  • Chain 'D':
    Compound: Nicotinic acid mononucleotide adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1k4kd_
  • Heterogens: XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k4kA (A:)
    mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
    elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
    etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
    atiirerlqngescedllpepvltyinqqglyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k4kB (B:)
    mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
    elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
    etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
    atiirerlqngescedllpepvltyinqqglyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4kB (B:)
    mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
    elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdsletildnahl
    ivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnisatiirerlq
    ngescedllpepvltyinqqglyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k4kC (C:)
    mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
    elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
    etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
    atiirerlqngescedllpepvltyinqqglyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k4kD (D:)
    mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
    elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
    etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
    atiirerlqngescedllpepvltyinqqglyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4kD (D:)
    mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
    elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
    etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
    atiirerlqngescedllpepvltyinqqgly