PDB entry 1k4j

View 1k4j on RCSB PDB site
Description: Crystal Structure of the Acyl-homoserinelactone Synthase EsaI Complexed with Rhenate
Class: ligase
Keywords: acyl-homoserinelactone synthase, mixed alpha beta, enzyme, GNAT similarity, quorum sensing, autoinducer synthase, LIGASE
Deposited on 2001-10-08, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-homoserinelactone synthase EsaI
    Species: Pantoea stewartii subsp. stewartii [TaxId:66271]
    Gene: esaI/esaR cluster
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54656 (20-229)
      • expression tag (19)
    Domains in SCOPe 2.06: d1k4ja1, d1k4ja2
  • Heterogens: REO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4jA (A:)
    mgsshhhhhhssglvprgshmlelfdvsyeelqttrseelyklrkktfsdrlgwevicsq
    gmesdefdgpgtryilgicegqlvcsvrftsldrpnmithtfqhcfsdvtlpaygtessr
    ffvdkararallgehypisqvlflamvnwaqnnaygniytivsramlkiltrsgwqikvi
    keafltekeriylltlpagqddkqqlggdvvsrtgcppvavttwpltlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4jA (A:)
    hmlelfdvsyeelrlgwevicsqgmesdefdgpgtryilgicegqlvcsvrftsldrpnm
    ithtfqhcfsdvtlpaygtessrffvdkararallgehypisqvlflamvnwaqnnaygn
    iytivsramlkiltrsgwqikvikeafltekeriylltlpagqddkqqlggdvvsrtgcp
    pvavttwpltlpv