PDB entry 1k4i

View 1k4i on RCSB PDB site
Description: Crystal Structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase in complex with two Magnesium ions
Class: isomerase
Keywords: dihydroxybutanone phosphate synthase, riboflavin biosynthesis, antimicrobial target, structure-based design, ISOMERASE
Deposited on 2001-10-08, released 2002-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.178
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Gene: rice blast fungi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k4ia_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k4iA (A:)
    mpstdsipksnfdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrh
    ssglicapltperttaldlpqmvthnadprgtaytvsvdaehpstttgisahdralacrm
    laapdaqpshfrrpghvfplravaggvrarrghteagvelcrlagkrpvaviseivddgq
    evegravraapgmlrgdecvafarrwglkvctiedmiahvektegkletngsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4iA (A:)
    fdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrhssglicapltp
    erttaldlpqmvthnadprgtaytvsvdaehpstttgisahdralacrmlaapdaqpshf
    rrpghvfplravaggvrarrghteagvelcrlagkrpvaviseivddgqevegravraap
    gmlrgdecvafarrwglkvctiedmiahvektegkl