PDB entry 1k4d

View 1k4d on RCSB PDB site
Description: Potassium Channel KcsA-Fab complex in low concentration of K+
Class: membrane protein
Keywords: K channel, protein-antibody Fab complex
Deposited on 2001-10-07, released 2001-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1k4da1, d1k4da2
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1k4db1, d1k4db2
  • Chain 'C':
    Compound: potassium channel kcsa
    Species: Streptomyces lividans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOP 1.73: d1k4dc_
  • Heterogens: K, NA, DGA, F09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k4dA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k4dB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k4dC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k4dC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh