PDB entry 1k45

View 1k45 on RCSB PDB site
Description: The Solution Structure of the CBM4-2 Carbohydrate Binding Module from a Thermostable Rhodothermus marinus Xylanase.
Class: Hyrolase
Keywords: beta-sandwich formed by 11 strands. Binding-site cleft. Solvent exposed aromatics (Trp69, Phe110) in binding cleft. Two helical twists. Two calcium binding sites., Hyrolase
Deposited on 2001-10-05, released 2002-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Rhodothermus marinus [TaxId:29549]
    Gene: xyn10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96988 (1-163)
      • initiating methionine (0)
      • cloning artifact (164-167)
    Domains in SCOPe 2.07: d1k45a1, d1k45a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k45A (A:)
    mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
    vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
    ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaiasqp