PDB entry 1k44

View 1k44 on RCSB PDB site
Description: Mycobacterium tuberculosis Nucleoside Diphosphate Kinase
Class: transferase
Keywords: Nucleoside Triphosphate, Nucleoside Diphosphate, TRANSFERASE
Deposited on 2001-10-05, released 2002-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k44a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k44b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k44c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k44d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k44e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k44f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k44A (A:)
    mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffg
    sllefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsd
    saesaqreialwfpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k44A (A:)
    tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
    llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
    aesaqreialwfpga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k44B (B:)
    mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffg
    sllefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsd
    saesaqreialwfpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k44B (B:)
    tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
    llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
    aesaqreialwfpga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k44C (C:)
    mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffg
    sllefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsd
    saesaqreialwfpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k44C (C:)
    tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
    llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
    aesaqreialwfpga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k44D (D:)
    mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffg
    sllefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsd
    saesaqreialwfpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k44D (D:)
    tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
    llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
    aesaqreialwfpga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1k44E (E:)
    mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffg
    sllefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsd
    saesaqreialwfpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k44E (E:)
    tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
    llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
    aesaqreialwfpga
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1k44F (F:)
    mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffg
    sllefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsd
    saesaqreialwfpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k44F (F:)
    tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
    llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
    aesaqreialwfpga