PDB entry 1k42

View 1k42 on RCSB PDB site
Description: The Solution Structure of the CBM4-2 Carbohydrate Binding Module from a Thermostable Rhodothermus marinus Xylanase.
Class: Hydrolase
Keywords: beta-sandwich formed by 11 strands. Binding-site cleft. Solvent exposed aromatics (Trp69, Phe110) in binding cleft. Two helical twists. Two calcium binding sites.
Deposited on 2001-10-05, released 2002-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: xylanase
  Species: Rhodothermus marinus
  Gene: xyn10A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P96988 (1-163)
    • initiating methionine (0)
    • cloning artifact (164-167)
  Domains in SCOP 1.75: d1k42a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k42A (A:)
  mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
  vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
  ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaiasqp