PDB entry 1k3w

View 1k3w on RCSB PDB site
Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
Deposited on 2001-10-04, released 2002-10-04
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-04, with a file datestamp of 2002-10-04.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.165
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k3wA (A:)
    pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
    dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
    flqrvgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgl
    tgnhkakdlnaaqldalahalleiprfsyatrgqvdenkhhgalfrfkvfhrdgepcerc
    gsiiekttlssrpfywcpgcqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3wA (A:)
    pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
    dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
    flqrvgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgl
    tgnhkakdlnaaqldalahalleiprfsyatrgqalfrfkvfhrdgepcercgsiiektt
    lssrpfywcpgcqh