PDB entry 1k3t

View 1k3t on RCSB PDB site
Description:
Deposited on 2001-10-04, released 2002-06-19
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1k3ta1, d1k3ta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1k3tb1, d1k3tb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1k3tc1, d1k3tc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1k3td1, d1k3td2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3tA (A:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3tB (B:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3tC (C:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3tD (D:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl